RAPGEF6 Rabbit pAb, Polyclonal

Catalog Number: ABB-A17161
Article Name: RAPGEF6 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A17161
Supplier Catalog Number: A17161
Alternative Catalog Number: ABB-A17161-100UL,ABB-A17161-20UL,ABB-A17161-500UL,ABB-A17161-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: RAGEF2, PDZGEF2, KIA001LB, PDZ-GEF2, RA-GEF-2, RAPGEF6
Enables several functions, including GTP-dependent protein binding activity, guanyl-nucleotide exchange factor activity, and phosphatidic acid binding activity. Involved in microvillus assembly, positive regulation of GTPase activity, and protein localization to plasma membrane. Located in several cellular components, including apical plasma membrane, centrosome, and endocytic vesicle.
Clonality: Polyclonal
Molecular Weight: 179kDa
NCBI: 51735
UniProt: Q8TEU7
Purity: Affinity purification
Sequence: INYKGERQTITDDVEVNSYLSLPADLTKMHLTENPHPQVTHVSSSQSGCSIASDSGSSSLSDIYQATESEVGDVDLTRLPEGPVDSEDDEEEDEEI
Target: RAPGEF6
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,Small G proteins. Shipping: Ice Bag
Western blot analysis of various lysates using RAPGEF6 Rabbit pAb (A17161) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.