TAS1R2 Rabbit pAb, Polyclonal

Artikelnummer: ABB-A17218
Artikelname: TAS1R2 Rabbit pAb, Polyclonal
Artikelnummer: ABB-A17218
Hersteller Artikelnummer: A17218
Alternativnummer: ABB-A17218-20UL,ABB-A17218-100UL,ABB-A17218-500UL,ABB-A17218-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Synonym: TR2, T1R2, GPR71, TAS1R2
Contributes to sweet taste receptor activity. Involved in detection of chemical stimulus involved in sensory perception of sweet taste and positive regulation of cytokinesis. Part of sweet taste receptor complex.
Klonalität: Polyclonal
Molekulargewicht: 95kDa
NCBI: 80834
UniProt: Q8TE23
Reinheit: Affinity purification
Sequenz: IVQWQWDRSQNPFQSVASYYPLQRQLKNIQDISWHTINNTIPMSMCSKRCQSGQKKKPVGIHVCCFECIDCLPGTFLNHTEDEYECQACPNNEWSYQSETS
Target-Kategorie: TAS1R2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using TAS1R2 Rabbit pAb (A17218) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5min.