TAS1R2 Rabbit pAb, Polyclonal

Catalog Number: ABB-A17218
Article Name: TAS1R2 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A17218
Supplier Catalog Number: A17218
Alternative Catalog Number: ABB-A17218-20UL,ABB-A17218-100UL,ABB-A17218-500UL,ABB-A17218-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Names: TR2, T1R2, GPR71, TAS1R2
Contributes to sweet taste receptor activity. Involved in detection of chemical stimulus involved in sensory perception of sweet taste and positive regulation of cytokinesis. Part of sweet taste receptor complex.
Clonality: Polyclonal
Molecular Weight: 95kDa
NCBI: 80834
UniProt: Q8TE23
Purity: Affinity purification
Sequence: IVQWQWDRSQNPFQSVASYYPLQRQLKNIQDISWHTINNTIPMSMCSKRCQSGQKKKPVGIHVCCFECIDCLPGTFLNHTEDEYECQACPNNEWSYQSETS
Target: TAS1R2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using TAS1R2 Rabbit pAb (A17218) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5min.