RPF2 Rabbit pAb, Polyclonal

Artikelnummer: ABB-A17224
Artikelname: RPF2 Rabbit pAb, Polyclonal
Artikelnummer: ABB-A17224
Hersteller Artikelnummer: A17224
Alternativnummer: ABB-A17224-20UL,ABB-A17224-100UL,ABB-A17224-1000UL,ABB-A17224-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Synonym: BXDC1, bA397G5.4, RPF2
Enables 5S rRNA binding activity. Involved in protein localization to nucleolus, regulation of signal transduction by p53 class mediator, and ribosomal large subunit biogenesis. Located in chromosome, nucleolus, and nucleoplasm.
Klonalität: Polyclonal
Molekulargewicht: 36kDa
NCBI: 84154
UniProt: Q9H7B2
Reinheit: Affinity purification
Sequenz: MDTLDRVVKPKTKRAKRFLEKREPKLNENIKNAMLIKGGNANATVTKVLKDVYALKKPYGVLYKKKNITRPFEDQTSLEFFSKKSDCSLFMFGSHNKKRPNNLVIGRMYDYHVLDMIELGIENFVSLKDIKNSKCPEGTKPMLIFAGDDFDVTEDYRRLKSLLIDFFRGPTVSNIRLAGLEYVLHFTALNGKIYFRSYKLLLKKSGCRTPRIELEEMGPSLDLVLRRTHLASDDLYKLSMKMPKALKPKKKKNIS
Target-Kategorie: RPF2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology. Shipping: Ice Bag
Western blot analysis of lysates from HeLa cells, using RPF2 Rabbit pAb (A17224) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.