RPF2 Rabbit pAb, Polyclonal
Catalog Number:
ABB-A17224
- Images (1)
| Article Name: | RPF2 Rabbit pAb, Polyclonal |
| Biozol Catalog Number: | ABB-A17224 |
| Supplier Catalog Number: | A17224 |
| Alternative Catalog Number: | ABB-A17224-20UL,ABB-A17224-100UL,ABB-A17224-1000UL,ABB-A17224-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Names: | BXDC1, bA397G5.4, RPF2 |
| Enables 5S rRNA binding activity. Involved in protein localization to nucleolus, regulation of signal transduction by p53 class mediator, and ribosomal large subunit biogenesis. Located in chromosome, nucleolus, and nucleoplasm. |
| Clonality: | Polyclonal |
| Molecular Weight: | 36kDa |
| NCBI: | 84154 |
| UniProt: | Q9H7B2 |
| Purity: | Affinity purification |
| Sequence: | MDTLDRVVKPKTKRAKRFLEKREPKLNENIKNAMLIKGGNANATVTKVLKDVYALKKPYGVLYKKKNITRPFEDQTSLEFFSKKSDCSLFMFGSHNKKRPNNLVIGRMYDYHVLDMIELGIENFVSLKDIKNSKCPEGTKPMLIFAGDDFDVTEDYRRLKSLLIDFFRGPTVSNIRLAGLEYVLHFTALNGKIYFRSYKLLLKKSGCRTPRIELEEMGPSLDLVLRRTHLASDDLYKLSMKMPKALKPKKKKNIS |
| Target: | RPF2 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from HeLa cells, using RPF2 Rabbit pAb (A17224) at 1:500 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s. |
Product Guarantee and Expert Support
