DOCK7 Rabbit pAb, Polyclonal

Artikelnummer: ABB-A17236
Artikelname: DOCK7 Rabbit pAb, Polyclonal
Artikelnummer: ABB-A17236
Hersteller Artikelnummer: A17236
Alternativnummer: ABB-A17236-100UL,ABB-A17236-20UL,ABB-A17236-500UL,ABB-A17236-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Synonym: ZIR2, DEE23, EIEE23, DOCK7
The protein encoded by this gene is a guanine nucleotide exchange factor (GEF) that plays a role in axon formation and neuronal polarization. The encoded protein displays GEF activity toward RAC1 and RAC3 Rho small GTPases but not toward CDC42. Several transcript variants encoding different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 243kDa
NCBI: 85440
UniProt: Q96N67
Reinheit: Affinity purification
Sequenz: VSAVPEESEMDPHVRDCIRSYTEDWAIVIRKYHKLGTGFNPNTLDKQKERQKGLPKQVFESDEAPDGNSYQDDQDDLKRRSMSIDDTPRGSWACSIFDLKN
Target-Kategorie: DOCK7
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,Small G proteins,Cell Biology Developmental Biology,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using DOCK7 Rabbit pAb (A17236) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.