DOCK7 Rabbit pAb, Polyclonal

Catalog Number: ABB-A17236
Article Name: DOCK7 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A17236
Supplier Catalog Number: A17236
Alternative Catalog Number: ABB-A17236-100UL,ABB-A17236-20UL,ABB-A17236-500UL,ABB-A17236-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Names: ZIR2, DEE23, EIEE23, DOCK7
The protein encoded by this gene is a guanine nucleotide exchange factor (GEF) that plays a role in axon formation and neuronal polarization. The encoded protein displays GEF activity toward RAC1 and RAC3 Rho small GTPases but not toward CDC42. Several transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 243kDa
NCBI: 85440
UniProt: Q96N67
Purity: Affinity purification
Sequence: VSAVPEESEMDPHVRDCIRSYTEDWAIVIRKYHKLGTGFNPNTLDKQKERQKGLPKQVFESDEAPDGNSYQDDQDDLKRRSMSIDDTPRGSWACSIFDLKN
Target: DOCK7
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,Small G proteins,Cell Biology Developmental Biology,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using DOCK7 Rabbit pAb (A17236) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.