PRKCDBP Rabbit pAb, Polyclonal

Artikelnummer: ABB-A17247
Artikelname: PRKCDBP Rabbit pAb, Polyclonal
Artikelnummer: ABB-A17247
Hersteller Artikelnummer: A17247
Alternativnummer: ABB-A17247-20UL,ABB-A17247-100UL,ABB-A17247-1000UL,ABB-A17247-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Synonym: SRBC, HSRBC, PRKCDBP, cavin-3
The protein encoded by this gene was identified as a binding protein of the protein kinase C, delta (PRKCD). The expression of this gene in cultured cell lines is strongly induced by serum starvation. The expression of this protein was found to be down-regulated in various cancer cell lines, suggesting the possible tumor suppressor function of this protein.
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 112464
UniProt: Q969G5
Reinheit: Affinity purification
Sequenz: SNTLAQLLAKAERVSSHANAAQERAVRRAAQVQRLEANHGLLVARGKLHVLLFKEEGEVPASAFQKAPEPLGPADQSELGPEQLEA
Target-Kategorie: CAVIN3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Rat. ResearchArea: Cancer,Tumor suppressors,Kinase. Shipping: Ice Bag
Western blot analysis of lysates from Rat heart, using PRKCDBP Rabbit pAb (A17247) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.