PRKCDBP Rabbit pAb, Polyclonal

Catalog Number: ABB-A17247
Article Name: PRKCDBP Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A17247
Supplier Catalog Number: A17247
Alternative Catalog Number: ABB-A17247-20UL,ABB-A17247-100UL,ABB-A17247-1000UL,ABB-A17247-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: SRBC, HSRBC, PRKCDBP, cavin-3
The protein encoded by this gene was identified as a binding protein of the protein kinase C, delta (PRKCD). The expression of this gene in cultured cell lines is strongly induced by serum starvation. The expression of this protein was found to be down-regulated in various cancer cell lines, suggesting the possible tumor suppressor function of this protein.
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 112464
UniProt: Q969G5
Purity: Affinity purification
Sequence: SNTLAQLLAKAERVSSHANAAQERAVRRAAQVQRLEANHGLLVARGKLHVLLFKEEGEVPASAFQKAPEPLGPADQSELGPEQLEA
Target: CAVIN3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Rat. ResearchArea: Cancer,Tumor suppressors,Kinase. Shipping: Ice Bag
Western blot analysis of lysates from Rat heart, using PRKCDBP Rabbit pAb (A17247) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.