SLC26A11 Rabbit pAb, Polyclonal

Artikelnummer: ABB-A17276
Artikelname: SLC26A11 Rabbit pAb, Polyclonal
Artikelnummer: ABB-A17276
Hersteller Artikelnummer: A17276
Alternativnummer: ABB-A17276-20UL,ABB-A17276-100UL,ABB-A17276-500UL,ABB-A17276-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Synonym: SLC26A11
This gene encodes a member of the solute linked carrier 26 family of anion exchangers. Members of this family of proteins are essential for numerous cellular functions including homeostasis and intracellular electrolyte balance. The encoded protein is a sodium independent sulfate transporter that is sensitive to the anion exchanger inhibitor 4,4-diisothiocyanostilbene-2,2-disulfonic acid. Alternate splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 65kDa
NCBI: 284129
UniProt: Q86WA9
Reinheit: Affinity purification
Sequenz: EILSRALEVSPPRCLVLECTHVCSIDYTVVLGLGELLQDFQKQGVALAFVGLQVPVLRVLLSADLKGFQYFSTLEEAEKHLRQEPGTQPYNIREDSILDQK
Target-Kategorie: SLC26A11
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse. Shipping: Ice Bag
Western blot analysis of various lysates using SLC26A11 Rabbit pAb (A17276) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.