SLC26A11 Rabbit pAb, Polyclonal

Catalog Number: ABB-A17276
Article Name: SLC26A11 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A17276
Supplier Catalog Number: A17276
Alternative Catalog Number: ABB-A17276-20UL,ABB-A17276-100UL,ABB-A17276-500UL,ABB-A17276-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Names: SLC26A11
This gene encodes a member of the solute linked carrier 26 family of anion exchangers. Members of this family of proteins are essential for numerous cellular functions including homeostasis and intracellular electrolyte balance. The encoded protein is a sodium independent sulfate transporter that is sensitive to the anion exchanger inhibitor 4,4-diisothiocyanostilbene-2,2-disulfonic acid. Alternate splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 65kDa
NCBI: 284129
UniProt: Q86WA9
Purity: Affinity purification
Sequence: EILSRALEVSPPRCLVLECTHVCSIDYTVVLGLGELLQDFQKQGVALAFVGLQVPVLRVLLSADLKGFQYFSTLEEAEKHLRQEPGTQPYNIREDSILDQK
Target: SLC26A11
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. Shipping: Ice Bag
Western blot analysis of various lysates using SLC26A11 Rabbit pAb (A17276) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.