Mucin 5AC Rabbit pAb, Polyclonal
Artikelnummer:
ABB-A17325
- Bilder (1)
| Artikelname: | Mucin 5AC Rabbit pAb, Polyclonal |
| Artikelnummer: | ABB-A17325 |
| Hersteller Artikelnummer: | A17325 |
| Alternativnummer: | ABB-A17325-20UL,ABB-A17325-100UL,ABB-A17325-500UL,ABB-A17325-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Synthetic peptide. This information is considered to be commercially sensitive. |
| Alternative Synonym: | TBM, leB, MUC5, mucin, Mucin 5AC (MUC5AC) |
| Predicted to be an extracellular matrix structural constituent. Involved in phosphatidylinositol-mediated signaling. Located in cytoplasm, extracellular space, and mucus layer. Implicated in dry eye syndrome. Biomarker of several diseases, including Sjogrens syndrome, biliary tract disease (multiple), cystic fibrosis, eye disease (multiple), and pancreatic cancer (multiple). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 586kDa |
| NCBI: | 4586 |
| UniProt: | P98088 |
| Reinheit: | Affinity purification |
| Sequenz: | TSSMSTTAPGTSVVSSKPTPTEPSTSSCLQELCTWTEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICSHTEGLICLNKNQLPPICYNYEIRIQCCETVNVCRDITRLPKTVATTRPTPHPTGAQTQTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTLVTRNCHPRCTWTKWFDVDFPSPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEH |
| Target-Kategorie: | MUC5AC |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor immunology,Tumor-associated antigens,Tumor biomarkers,Invasion and Metastasis,Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Immunology Inflammation. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Mouse stomach, using Mucin 5AC (MUC5AC) Rabbit pAb (A17325) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 3s. |
Produktgarantie und fachkundiger Support
