Mucin 5AC Rabbit pAb, Polyclonal

Catalog Number: ABB-A17325
Article Name: Mucin 5AC Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A17325
Supplier Catalog Number: A17325
Alternative Catalog Number: ABB-A17325-20UL,ABB-A17325-100UL,ABB-A17325-500UL,ABB-A17325-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Names: TBM, leB, MUC5, mucin, Mucin 5AC (MUC5AC)
Predicted to be an extracellular matrix structural constituent. Involved in phosphatidylinositol-mediated signaling. Located in cytoplasm, extracellular space, and mucus layer. Implicated in dry eye syndrome. Biomarker of several diseases, including Sjogrens syndrome, biliary tract disease (multiple), cystic fibrosis, eye disease (multiple), and pancreatic cancer (multiple).
Clonality: Polyclonal
Molecular Weight: 586kDa
NCBI: 4586
UniProt: P98088
Purity: Affinity purification
Sequence: TSSMSTTAPGTSVVSSKPTPTEPSTSSCLQELCTWTEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICSHTEGLICLNKNQLPPICYNYEIRIQCCETVNVCRDITRLPKTVATTRPTPHPTGAQTQTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTLVTRNCHPRCTWTKWFDVDFPSPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEH
Target: MUC5AC
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor immunology,Tumor-associated antigens,Tumor biomarkers,Invasion and Metastasis,Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Immunology Inflammation. Shipping: Ice Bag
Western blot analysis of lysates from Mouse stomach, using Mucin 5AC (MUC5AC) Rabbit pAb (A17325) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.