MOBP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17355
Artikelname: MOBP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17355
Hersteller Artikelnummer: A17355
Alternativnummer: ABB-A17355-100UL,ABB-A17355-20UL,ABB-A17355-500UL,ABB-A17355-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: MOBP
Predicted to enable actin binding activity and myosin binding activity. Predicted to be a structural constituent of myelin sheath. Predicted to be involved in nervous system development. Predicted to be located in mitochondrion. Predicted to be active in cortical actin cytoskeleton. Implicated in frontotemporal dementia.
Klonalität: Polyclonal
Molekulargewicht: 21kDa
NCBI: 4336
UniProt: Q13875
Reinheit: Affinity purification
Sequenz: MSQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGCFYQKKEEDWICCACQKTRL
Target-Kategorie: MOBP
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Neuroscience, Cell Type Marker. Shipping: Ice Bag
Western blot analysis of various lysates using MOBP Rabbit pAb (A17355) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.