MOBP Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17355
Article Name: MOBP Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17355
Supplier Catalog Number: A17355
Alternative Catalog Number: ABB-A17355-100UL,ABB-A17355-20UL,ABB-A17355-500UL,ABB-A17355-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: MOBP
Predicted to enable actin binding activity and myosin binding activity. Predicted to be a structural constituent of myelin sheath. Predicted to be involved in nervous system development. Predicted to be located in mitochondrion. Predicted to be active in cortical actin cytoskeleton. Implicated in frontotemporal dementia.
Clonality: Polyclonal
Molecular Weight: 21kDa
NCBI: 4336
UniProt: Q13875
Purity: Affinity purification
Sequence: MSQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGCFYQKKEEDWICCACQKTRL
Target: MOBP
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Neuroscience, Cell Type Marker. Shipping: Ice Bag
Western blot analysis of various lysates using MOBP Rabbit pAb (A17355) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.