SIX3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17363
Artikelname: SIX3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17363
Hersteller Artikelnummer: A17363
Alternativnummer: ABB-A17363-100UL,ABB-A17363-20UL,ABB-A17363-500UL,ABB-A17363-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HPE2, SIX3
This gene encodes a member of the sine oculis homeobox transcription factor family. The encoded protein plays a role in eye development. Mutations in this gene have been associated with holoprosencephaly type 2.
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 6496
UniProt: O95343
Reinheit: Affinity purification
Sequenz: VGNWFKNRRQRDRAAAAKNRLQHQAIGPSGMRSLAEPGCPTHGSAESPSTAASPTTSVSSLTERADTGTSILSVTSSDSECDV
Target-Kategorie: SIX3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. Shipping: Ice Bag
Western blot analysis of various lysates using SIX3 Rabbit pAb (A17363) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.