SIX3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17363
Article Name: SIX3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17363
Supplier Catalog Number: A17363
Alternative Catalog Number: ABB-A17363-100UL,ABB-A17363-20UL,ABB-A17363-500UL,ABB-A17363-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HPE2, SIX3
This gene encodes a member of the sine oculis homeobox transcription factor family. The encoded protein plays a role in eye development. Mutations in this gene have been associated with holoprosencephaly type 2.
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 6496
UniProt: O95343
Purity: Affinity purification
Sequence: VGNWFKNRRQRDRAAAAKNRLQHQAIGPSGMRSLAEPGCPTHGSAESPSTAASPTTSVSSLTERADTGTSILSVTSSDSECDV
Target: SIX3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. Shipping: Ice Bag
Western blot analysis of various lysates using SIX3 Rabbit pAb (A17363) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.