CAPRIN2 Rabbit pAb, Polyclonal
Artikelnummer:
ABB-A17365
- Bilder (1)
| Artikelname: | CAPRIN2 Rabbit pAb, Polyclonal |
| Artikelnummer: | ABB-A17365 |
| Hersteller Artikelnummer: | A17365 |
| Alternativnummer: | ABB-A17365-20UL,ABB-A17365-100UL,ABB-A17365-500UL,ABB-A17365-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Synonym: | EEG1, EEG-1, C1QDC1, RNG140, CAPRIN2 |
| The protein encoded by this gene may regulate the transport of mRNA. It may play a role in the differentiation of erythroblasts. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 126kDa |
| NCBI: | 65981 |
| UniProt: | Q6IMN6 |
| Reinheit: | Affinity purification |
| Sequenz: | QVNHSQHGESQRALSPLQSTLSSAASPSQAYETYIENGLICLKHKIRNIEKKKLKLEDYKDRLKSGEHLNPDQLEAVEKYEEVLHNLEFAKELQKTFSGLSLDLLKAQKKAQRREHMLKLEAEKKKLRTILQVQYVLQNLTQEHVQKDFKGGLNGAVYLPSKELDYLIKFSKLTCPERNESLSVEDQMEQSSLYFWDLLEGSEKAVVGTTYKHLKDLLSKLLNSGYFESIPVPKNAKEKEVP |
| Target-Kategorie: | CAPRIN2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Rat. ResearchArea: Cell Biology Developmental Biology,Cell Cycle,Cell differentiation,Stem Cells. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using CAPRIN2 Rabbit pAb (A17365) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 3min. |
Produktgarantie und fachkundiger Support
