CAPRIN2 Rabbit pAb, Polyclonal
Catalog Number:
ABB-A17365
- Images (1)
| Article Name: | CAPRIN2 Rabbit pAb, Polyclonal |
| Biozol Catalog Number: | ABB-A17365 |
| Supplier Catalog Number: | A17365 |
| Alternative Catalog Number: | ABB-A17365-20UL,ABB-A17365-100UL,ABB-A17365-500UL,ABB-A17365-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Names: | EEG1, EEG-1, C1QDC1, RNG140, CAPRIN2 |
| The protein encoded by this gene may regulate the transport of mRNA. It may play a role in the differentiation of erythroblasts. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Clonality: | Polyclonal |
| Molecular Weight: | 126kDa |
| NCBI: | 65981 |
| UniProt: | Q6IMN6 |
| Purity: | Affinity purification |
| Sequence: | QVNHSQHGESQRALSPLQSTLSSAASPSQAYETYIENGLICLKHKIRNIEKKKLKLEDYKDRLKSGEHLNPDQLEAVEKYEEVLHNLEFAKELQKTFSGLSLDLLKAQKKAQRREHMLKLEAEKKKLRTILQVQYVLQNLTQEHVQKDFKGGLNGAVYLPSKELDYLIKFSKLTCPERNESLSVEDQMEQSSLYFWDLLEGSEKAVVGTTYKHLKDLLSKLLNSGYFESIPVPKNAKEKEVP |
| Target: | CAPRIN2 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Rat. ResearchArea: Cell Biology Developmental Biology,Cell Cycle,Cell differentiation,Stem Cells. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using CAPRIN2 Rabbit pAb (A17365) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 3min. |
Product Guarantee and Expert Support
