CAPRIN2 Rabbit pAb, Polyclonal

Catalog Number: ABB-A17365
Article Name: CAPRIN2 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A17365
Supplier Catalog Number: A17365
Alternative Catalog Number: ABB-A17365-20UL,ABB-A17365-100UL,ABB-A17365-500UL,ABB-A17365-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: EEG1, EEG-1, C1QDC1, RNG140, CAPRIN2
The protein encoded by this gene may regulate the transport of mRNA. It may play a role in the differentiation of erythroblasts. Multiple transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 126kDa
NCBI: 65981
UniProt: Q6IMN6
Purity: Affinity purification
Sequence: QVNHSQHGESQRALSPLQSTLSSAASPSQAYETYIENGLICLKHKIRNIEKKKLKLEDYKDRLKSGEHLNPDQLEAVEKYEEVLHNLEFAKELQKTFSGLSLDLLKAQKKAQRREHMLKLEAEKKKLRTILQVQYVLQNLTQEHVQKDFKGGLNGAVYLPSKELDYLIKFSKLTCPERNESLSVEDQMEQSSLYFWDLLEGSEKAVVGTTYKHLKDLLSKLLNSGYFESIPVPKNAKEKEVP
Target: CAPRIN2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Rat. ResearchArea: Cell Biology Developmental Biology,Cell Cycle,Cell differentiation,Stem Cells. Shipping: Ice Bag
Western blot analysis of various lysates using CAPRIN2 Rabbit pAb (A17365) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.