COL9A2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17461
Artikelname: COL9A2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17461
Hersteller Artikelnummer: A17461
Alternativnummer: ABB-A17461-100UL,ABB-A17461-20UL,ABB-A17461-500UL,ABB-A17461-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: MED, EDM2, STL5, DJ39G22.4, COL9A2
This gene encodes one of the three alpha chains of type IX collagen, the major collagen component of hyaline cartilage. Type IX collagen, a heterotrimeric molecule, is usually found in tissues containing type II collagen, a fibrillar collagen. This chain is unusual in that, unlike the other two type IX alpha chains, it contains a covalently attached glycosaminoglycan side chain. Mutations in this gene are associated with multiple epiphyseal dysplasia.
Klonalität: Polyclonal
Molekulargewicht: 65kDa
NCBI: 1298
UniProt: Q14055
Reinheit: Affinity purification
Sequenz: RGEKGDPGEVGRGHPGMPGPPGIPGLPGRPGQAINGKDGDRGSPGAPGEAGRPGLPGPVGLPGFCEPAACLGASAYASARLTEPGSIKGP
Target-Kategorie: COL9A2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Rat. Shipping: Ice Bag
Western blot analysis of lysates from Rat liver, using COL9A2 Rabbit pAb (A17461) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5min.