COL9A2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17461
Article Name: COL9A2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17461
Supplier Catalog Number: A17461
Alternative Catalog Number: ABB-A17461-100UL,ABB-A17461-20UL,ABB-A17461-500UL,ABB-A17461-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: MED, EDM2, STL5, DJ39G22.4, COL9A2
This gene encodes one of the three alpha chains of type IX collagen, the major collagen component of hyaline cartilage. Type IX collagen, a heterotrimeric molecule, is usually found in tissues containing type II collagen, a fibrillar collagen. This chain is unusual in that, unlike the other two type IX alpha chains, it contains a covalently attached glycosaminoglycan side chain. Mutations in this gene are associated with multiple epiphyseal dysplasia.
Clonality: Polyclonal
Molecular Weight: 65kDa
NCBI: 1298
UniProt: Q14055
Purity: Affinity purification
Sequence: RGEKGDPGEVGRGHPGMPGPPGIPGLPGRPGQAINGKDGDRGSPGAPGEAGRPGLPGPVGLPGFCEPAACLGASAYASARLTEPGSIKGP
Target: COL9A2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Rat. Shipping: Ice Bag
Western blot analysis of lysates from Rat liver, using COL9A2 Rabbit pAb (A17461) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5min.