CDK18 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17515
Artikelname: CDK18 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17515
Hersteller Artikelnummer: A17515
Alternativnummer: ABB-A17515-20UL,ABB-A17515-100UL,ABB-A17515-1000UL,ABB-A17515-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PCTK3, PCTAIRE, PCTAIRE3, CDK18
Predicted to enable ATP binding activity, cyclin-dependent protein serine/threonine kinase activity, and protein serine kinase activity. Predicted to be involved in protein phosphorylation and regulation of transcription involved in G1/S transition of mitotic cell cycle. Predicted to be active in cytoplasm and nucleus.
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 5129
UniProt: Q07002
Reinheit: Affinity purification
Sequenz: EFRTYSFPCYLPQPLINHAPRLDTDGIHLLSSLLLYESKSRMSAEAALSHSYFRSLGERVHQLEDTASIFSLKEIQLQKDPGYRGLAFQQPGRGKNRRQSIF
Target-Kategorie: CDK18
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,Kinase. Shipping: Ice Bag
Western blot analysis of various lysates using CDK18 Rabbit pAb (A17515) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.