CDK18 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17515
Article Name: CDK18 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17515
Supplier Catalog Number: A17515
Alternative Catalog Number: ABB-A17515-20UL,ABB-A17515-100UL,ABB-A17515-1000UL,ABB-A17515-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PCTK3, PCTAIRE, PCTAIRE3, CDK18
Predicted to enable ATP binding activity, cyclin-dependent protein serine/threonine kinase activity, and protein serine kinase activity. Predicted to be involved in protein phosphorylation and regulation of transcription involved in G1/S transition of mitotic cell cycle. Predicted to be active in cytoplasm and nucleus.
Clonality: Polyclonal
Molecular Weight: 54kDa
NCBI: 5129
UniProt: Q07002
Purity: Affinity purification
Sequence: EFRTYSFPCYLPQPLINHAPRLDTDGIHLLSSLLLYESKSRMSAEAALSHSYFRSLGERVHQLEDTASIFSLKEIQLQKDPGYRGLAFQQPGRGKNRRQSIF
Target: CDK18
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,Kinase. Shipping: Ice Bag
Western blot analysis of various lysates using CDK18 Rabbit pAb (A17515) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.