TMF1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17542
Artikelname: TMF1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17542
Hersteller Artikelnummer: A17542
Alternativnummer: ABB-A17542-20UL,ABB-A17542-100UL,ABB-A17542-1000UL,ABB-A17542-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: TMF, ARA160, TMF1
Enables androgen receptor binding activity and nuclear receptor coactivator activity. Involved in androgen receptor signaling pathway and positive regulation of transcription by RNA polymerase II. Located in Golgi apparatus.
Klonalität: Polyclonal
Molekulargewicht: 123kDa
NCBI: 7110
UniProt: P82094
Reinheit: Affinity purification
Sequenz: MKVEQERKKAIFTQETIKEKERKPFSVSSTPTMSRSSSISGVDMAGLQTSFLSQDESHDHSFGPMPISANGSNLYDAVRMGAGSSIIENLQSQLKLREGEI
Target-Kategorie: TMF1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Nuclear Receptor Signaling,Nuclear hormone receptors,Signal Transduction. Shipping: Ice Bag
Western blot analysis of various lysates using TMF1 Rabbit pAb (A17542) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.