TMF1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17542
Article Name: TMF1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17542
Supplier Catalog Number: A17542
Alternative Catalog Number: ABB-A17542-20UL,ABB-A17542-100UL,ABB-A17542-1000UL,ABB-A17542-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: TMF, ARA160, TMF1
Enables androgen receptor binding activity and nuclear receptor coactivator activity. Involved in androgen receptor signaling pathway and positive regulation of transcription by RNA polymerase II. Located in Golgi apparatus.
Clonality: Polyclonal
Molecular Weight: 123kDa
NCBI: 7110
UniProt: P82094
Purity: Affinity purification
Sequence: MKVEQERKKAIFTQETIKEKERKPFSVSSTPTMSRSSSISGVDMAGLQTSFLSQDESHDHSFGPMPISANGSNLYDAVRMGAGSSIIENLQSQLKLREGEI
Target: TMF1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Nuclear Receptor Signaling,Nuclear hormone receptors,Signal Transduction. Shipping: Ice Bag
Western blot analysis of various lysates using TMF1 Rabbit pAb (A17542) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.