SYNJ1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17581
Artikelname: SYNJ1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17581
Hersteller Artikelnummer: A17581
Alternativnummer: ABB-A17581-100UL,ABB-A17581-20UL,ABB-A17581-500UL,ABB-A17581-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: DEE53, EIEE53, INPP5G, PARK20, SYNJ1
This gene encodes a phosphoinositide phosphatase that regulates levels of membrane phosphatidylinositol-4,5-bisphosphate. As such, expression of this enzyme may affect synaptic transmission and membrane trafficking. Multiple transcript variants encoding different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 173kDa
NCBI: 8867
UniProt: O43426
Reinheit: Affinity purification
Sequenz: GLLGVLRLNLGDTMLHYLVLVTGCMSVGKIQESEVFRVTSTEFISLRIDSSDEDRISEVRKVLNSGNFYFAWSASGISLDLSLNAHRSMQEQTTDNRFFWN
Target-Kategorie: SYNJ1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Rat. ResearchArea: Neuroscience, Cell Type Marker,Neuron marker,Synapse marker. Shipping: Ice Bag
Western blot analysis of various lysates using SYNJ1 Rabbit pAb (A17581) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.