SYNJ1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17581
Article Name: SYNJ1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17581
Supplier Catalog Number: A17581
Alternative Catalog Number: ABB-A17581-100UL,ABB-A17581-20UL,ABB-A17581-500UL,ABB-A17581-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: DEE53, EIEE53, INPP5G, PARK20, SYNJ1
This gene encodes a phosphoinositide phosphatase that regulates levels of membrane phosphatidylinositol-4,5-bisphosphate. As such, expression of this enzyme may affect synaptic transmission and membrane trafficking. Multiple transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 173kDa
NCBI: 8867
UniProt: O43426
Purity: Affinity purification
Sequence: GLLGVLRLNLGDTMLHYLVLVTGCMSVGKIQESEVFRVTSTEFISLRIDSSDEDRISEVRKVLNSGNFYFAWSASGISLDLSLNAHRSMQEQTTDNRFFWN
Target: SYNJ1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Rat. ResearchArea: Neuroscience, Cell Type Marker,Neuron marker,Synapse marker. Shipping: Ice Bag
Western blot analysis of various lysates using SYNJ1 Rabbit pAb (A17581) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.