LIMD1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A17585
- Bilder (1)
| Artikelname: | LIMD1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A17585 |
| Hersteller Artikelnummer: | A17585 |
| Alternativnummer: | ABB-A17585-100UL,ABB-A17585-20UL,ABB-A17585-500UL,ABB-A17585-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | LIMD1 |
| Predicted to enable transcription corepressor activity. Involved in several processes, including negative regulation of hippo signaling, regulation of gene expression, and response to hypoxia. Acts upstream of or within P-body assembly and gene silencing by miRNA. Located in several cellular components, including P-body, adherens junction, and focal adhesion. Part of RISC complex. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 72kDa |
| NCBI: | 8994 |
| UniProt: | Q9UGP4 |
| Reinheit: | Affinity purification |
| Sequenz: | MDKYDDLGLEASKFIEDLNMYEASKDGLFRVDKGAGNNPEFEETRRVFATKMAKIHLQQQQQQLLQEETLPRGSRGPVNGGGRLGPQARWEVVGSKLTVDGAAKPPLAASTGAPGAVTTLAAGQPPYPPQEQRSRPYLHGTRHGSQDCGSRESLATSEMSAFHQPGPCEDPSCLTHGDYYDNLSLASPKWGDKPGVSPSI |
| Target-Kategorie: | LIMD1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using LIMD1 Rabbit pAb (A17585) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Produktgarantie und fachkundiger Support
