LIMD1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17585
Article Name: LIMD1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17585
Supplier Catalog Number: A17585
Alternative Catalog Number: ABB-A17585-100UL,ABB-A17585-20UL,ABB-A17585-500UL,ABB-A17585-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: LIMD1
Predicted to enable transcription corepressor activity. Involved in several processes, including negative regulation of hippo signaling, regulation of gene expression, and response to hypoxia. Acts upstream of or within P-body assembly and gene silencing by miRNA. Located in several cellular components, including P-body, adherens junction, and focal adhesion. Part of RISC complex.
Clonality: Polyclonal
Molecular Weight: 72kDa
NCBI: 8994
UniProt: Q9UGP4
Purity: Affinity purification
Sequence: MDKYDDLGLEASKFIEDLNMYEASKDGLFRVDKGAGNNPEFEETRRVFATKMAKIHLQQQQQQLLQEETLPRGSRGPVNGGGRLGPQARWEVVGSKLTVDGAAKPPLAASTGAPGAVTTLAAGQPPYPPQEQRSRPYLHGTRHGSQDCGSRESLATSEMSAFHQPGPCEDPSCLTHGDYYDNLSLASPKWGDKPGVSPSI
Target: LIMD1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using LIMD1 Rabbit pAb (A17585) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.