ITGBL1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17592
Artikelname: ITGBL1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17592
Hersteller Artikelnummer: A17592
Alternativnummer: ABB-A17592-100UL,ABB-A17592-20UL,ABB-A17592-1000UL,ABB-A17592-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: OSCP, TIED, ITGBL1
This gene encodes a beta integrin-related protein that is a member of the EGF-like protein family. The encoded protein contains integrin-like cysteine-rich repeats. Alternative splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 9358
UniProt: O95965
Reinheit: Affinity purification
Sequenz: CYCGNCYCKAGWHGDKCEFQCDITPWESKRRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCD
Target-Kategorie: ITGBL1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Growth factors. Shipping: Ice Bag
Western blot analysis of various lysates using ITGBL1 Rabbit pAb (A17592) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.