ITGBL1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17592
Article Name: ITGBL1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17592
Supplier Catalog Number: A17592
Alternative Catalog Number: ABB-A17592-100UL,ABB-A17592-20UL,ABB-A17592-1000UL,ABB-A17592-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: OSCP, TIED, ITGBL1
This gene encodes a beta integrin-related protein that is a member of the EGF-like protein family. The encoded protein contains integrin-like cysteine-rich repeats. Alternative splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 54kDa
NCBI: 9358
UniProt: O95965
Purity: Affinity purification
Sequence: CYCGNCYCKAGWHGDKCEFQCDITPWESKRRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCD
Target: ITGBL1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Growth factors. Shipping: Ice Bag
Western blot analysis of various lysates using ITGBL1 Rabbit pAb (A17592) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.