TOM1L1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17602
Artikelname: TOM1L1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17602
Hersteller Artikelnummer: A17602
Alternativnummer: ABB-A17602-20UL,ABB-A17602-100UL,ABB-A17602-1000UL,ABB-A17602-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: SRCASM, TOM1L1
Enables clathrin binding activity and protein kinase binding activity. Involved in negative regulation of mitotic nuclear division, positive regulation of protein phosphorylation, and signal transduction. Located in cytosol and endosome.
Klonalität: Polyclonal
Molekulargewicht: 53kDa
NCBI: 10040
UniProt: O75674
Reinheit: Affinity purification
Sequenz: QERIMDLLVVVENEDVTVELIQVNEDLNNAILGYERFTRNQQRILEQNKNQKEATNTTSEPSAPSQDLLDLSPSPRMPRATLGELNTMNNQLSGLNFSLPS
Target-Kategorie: TOM1L1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Kinase,Tyrosine kinases. Shipping: Ice Bag
Western blot analysis of various lysates using TOM1L1 Rabbit pAb (A17602) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.