TOM1L1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17602
Article Name: TOM1L1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17602
Supplier Catalog Number: A17602
Alternative Catalog Number: ABB-A17602-20UL,ABB-A17602-100UL,ABB-A17602-1000UL,ABB-A17602-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SRCASM, TOM1L1
Enables clathrin binding activity and protein kinase binding activity. Involved in negative regulation of mitotic nuclear division, positive regulation of protein phosphorylation, and signal transduction. Located in cytosol and endosome.
Clonality: Polyclonal
Molecular Weight: 53kDa
NCBI: 10040
UniProt: O75674
Purity: Affinity purification
Sequence: QERIMDLLVVVENEDVTVELIQVNEDLNNAILGYERFTRNQQRILEQNKNQKEATNTTSEPSAPSQDLLDLSPSPRMPRATLGELNTMNNQLSGLNFSLPS
Target: TOM1L1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Kinase,Tyrosine kinases. Shipping: Ice Bag
Western blot analysis of various lysates using TOM1L1 Rabbit pAb (A17602) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.