NPM3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17612
Artikelname: NPM3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17612
Hersteller Artikelnummer: A17612
Alternativnummer: ABB-A17612-100UL,ABB-A17612-20UL,ABB-A17612-500UL,ABB-A17612-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PORMIN, TMEM123, NPM3
The protein encoded by this gene is related to the nuclear chaperone phosphoproteins, nucleoplasmin and nucleophosmin. This protein is strongly expressed in diverse cell types where it localizes primarily to the nucleus. Based on its similarity to nucleoplasmin and nucleophosmin, this protein likely functions as a molecular chaperone in the cell nucleus.
Klonalität: Polyclonal
Molekulargewicht: 19kDa
NCBI: 10360
UniProt: O75607
Reinheit: Affinity purification
Sequenz: APVTMDSFFFGCELSGHTRSFTFKVEEEDDAEHVLALTMLCLTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPVTFRLKSGSGPVRITGRHQIV
Target-Kategorie: NPM3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction. Shipping: Ice Bag
Western blot analysis of various lysates using NPM3 Rabbit pAb (A17612) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.