NPM3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17612
Article Name: NPM3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17612
Supplier Catalog Number: A17612
Alternative Catalog Number: ABB-A17612-100UL,ABB-A17612-20UL,ABB-A17612-500UL,ABB-A17612-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PORMIN, TMEM123, NPM3
The protein encoded by this gene is related to the nuclear chaperone phosphoproteins, nucleoplasmin and nucleophosmin. This protein is strongly expressed in diverse cell types where it localizes primarily to the nucleus. Based on its similarity to nucleoplasmin and nucleophosmin, this protein likely functions as a molecular chaperone in the cell nucleus.
Clonality: Polyclonal
Molecular Weight: 19kDa
NCBI: 10360
UniProt: O75607
Purity: Affinity purification
Sequence: APVTMDSFFFGCELSGHTRSFTFKVEEEDDAEHVLALTMLCLTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPVTFRLKSGSGPVRITGRHQIV
Target: NPM3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction. Shipping: Ice Bag
Western blot analysis of various lysates using NPM3 Rabbit pAb (A17612) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.