FGFR1OP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17627
Artikelname: FGFR1OP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17627
Hersteller Artikelnummer: A17627
Alternativnummer: ABB-A17627-100UL,ABB-A17627-20UL,ABB-A17627-1000UL,ABB-A17627-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: FOP, FGFR1OP
This gene encodes a largely hydrophilic centrosomal protein that is required for anchoring microtubules to subcellular structures. A t(6,8)(q27,p11) chromosomal translocation, fusing this gene and the fibroblast growth factor receptor 1 (FGFR1) gene, has been found in cases of myeloproliferative disorder. The resulting chimeric protein contains the N-terminal leucine-rich region of this encoded protein fused to the catalytic domain of FGFR1. Alterations in this gene may also be associated with Crohns disease, Graves disease, and vitiligo. Alternatively spliced transcript variants that encode different proteins have been identified.
Klonalität: Polyclonal
Molekulargewicht: 43kDa
NCBI: 11116
UniProt: O95684
Reinheit: Affinity purification
Sequenz: MAATAAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNESLKKFLNTKD
Target-Kategorie: CEP43
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Cancer,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Growth factors. Shipping: Ice Bag
Western blot analysis of various lysates using FGFR1OP Rabbit pAb (A17627) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.