BAZ2A / TIP5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A17629
- Bilder (1)
| Artikelname: | BAZ2A / TIP5 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A17629 |
| Hersteller Artikelnummer: | A17629 |
| Alternativnummer: | ABB-A17629-100UL,ABB-A17629-20UL,ABB-A17629-500UL,ABB-A17629-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | TIP5, WALp3, BAZ2A / TIP5 |
| Enables histone binding activity. Contributes to RNA polymerase I core promoter sequence-specific DNA binding activity. Predicted to be involved in DNA methylation, histone deacetylation, and negative regulation of macromolecule metabolic process. Predicted to act upstream of or within chromatin organization and histone modification. Located in cytosol and nuclear speck. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 211kDa |
| NCBI: | 11176 |
| UniProt: | Q9UIF9 |
| Reinheit: | Affinity purification |
| Sequenz: | QYPSANPGSNLKDPPLLSQFSGGQYPLNGILGGSRQPSSPSHNTNLRAGSQEFWANGTQSPMGLNFDSQELYDSFPDQNFEVMPNGPPSFFTSPQTSPMLGSSIQTFAPSQEVGSGIHPDEAAEKEMTSVVAENGTGLVGSLELEEEQPELKMCGYNGSVPSVESLHQEVSVLVPDPTVSCLDDPSHLPDQLEDTPILS |
| Target-Kategorie: | BAZ2A |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using BAZ2A / TIP5 Rabbit pAb (A17629) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
