BAZ2A / TIP5 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A17629
- Images (1)
| Article Name: | BAZ2A / TIP5 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A17629 |
| Supplier Catalog Number: | A17629 |
| Alternative Catalog Number: | ABB-A17629-100UL,ABB-A17629-20UL,ABB-A17629-500UL,ABB-A17629-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | TIP5, WALp3, BAZ2A / TIP5 |
| Enables histone binding activity. Contributes to RNA polymerase I core promoter sequence-specific DNA binding activity. Predicted to be involved in DNA methylation, histone deacetylation, and negative regulation of macromolecule metabolic process. Predicted to act upstream of or within chromatin organization and histone modification. Located in cytosol and nuclear speck. |
| Clonality: | Polyclonal |
| Molecular Weight: | 211kDa |
| NCBI: | 11176 |
| UniProt: | Q9UIF9 |
| Purity: | Affinity purification |
| Sequence: | QYPSANPGSNLKDPPLLSQFSGGQYPLNGILGGSRQPSSPSHNTNLRAGSQEFWANGTQSPMGLNFDSQELYDSFPDQNFEVMPNGPPSFFTSPQTSPMLGSSIQTFAPSQEVGSGIHPDEAAEKEMTSVVAENGTGLVGSLELEEEQPELKMCGYNGSVPSVESLHQEVSVLVPDPTVSCLDDPSHLPDQLEDTPILS |
| Target: | BAZ2A |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using BAZ2A / TIP5 Rabbit pAb (A17629) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
