PCNX1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17647
Artikelname: PCNX1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17647
Hersteller Artikelnummer: A17647
Alternativnummer: ABB-A17647-20UL,ABB-A17647-100UL,ABB-A17647-500UL,ABB-A17647-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PCNX, PCNXL1, pecanex, PCNX1
This gene encodes an evolutionarily conserved transmembrane protein similar to the pecanex protein in Drosophila. The fly protein is a component of the Notch signaling pathway, which functions in several developmental processes.
Klonalität: Polyclonal
Molekulargewicht: 259kDa
NCBI: 22990
UniProt: Q96RV3
Reinheit: Affinity purification
Sequenz: VDPSQILEGINLSKRKELQWPDEGIRLKAGRNSWKDWSPQEGMEGHVIHRWVPCSRDPGTRSHIDKAVLLVQIDDKYVTVIETGVLELGAEV
Target-Kategorie: PCNX1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using PCNX1 Rabbit pAb (A17647) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.