PCNX1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17647
Article Name: PCNX1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17647
Supplier Catalog Number: A17647
Alternative Catalog Number: ABB-A17647-20UL,ABB-A17647-100UL,ABB-A17647-500UL,ABB-A17647-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PCNX, PCNXL1, pecanex, PCNX1
This gene encodes an evolutionarily conserved transmembrane protein similar to the pecanex protein in Drosophila. The fly protein is a component of the Notch signaling pathway, which functions in several developmental processes.
Clonality: Polyclonal
Molecular Weight: 259kDa
NCBI: 22990
UniProt: Q96RV3
Purity: Affinity purification
Sequence: VDPSQILEGINLSKRKELQWPDEGIRLKAGRNSWKDWSPQEGMEGHVIHRWVPCSRDPGTRSHIDKAVLLVQIDDKYVTVIETGVLELGAEV
Target: PCNX1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using PCNX1 Rabbit pAb (A17647) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.