SCNN1B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A1765
- Bilder (1)
| Artikelname: | SCNN1B Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A1765 |
| Hersteller Artikelnummer: | A1765 |
| Alternativnummer: | ABB-A1765-100UL,ABB-A1765-20UL,ABB-A1765-1000UL,ABB-A1765-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BESC1, ENaCb, SCNEB, LIDLS1, PHA1B2, ENaCbeta, beta-ENaC, beta-NaCH, SCNN1B |
| Nonvoltage-gated, amiloride-sensitive, sodium channels control fluid and electrolyte transport across epithelia in many organs. These channels are heteromeric complexes consisting of 3 subunits: alpha, beta, and gamma. This gene encodes the beta subunit, and mutations in this gene have been associated with pseudohypoaldosteronism type 1 (PHA1), and Liddle syndrome. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 73kDa |
| NCBI: | 6338 |
| UniProt: | P51168 |
| Reinheit: | Affinity purification |
| Sequenz: | YPLPRGEKYCNNRDFPDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLSQERDQSTNITLSRKGIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWITIIKLVALAKSLRQRRAQASYAGPPPTVAELVEAHTNFGFQPDTAPRSPNTGPYPSEQALPIPGTPPPNYDSLRLQPLDVIESDSEGDAI |
| Target-Kategorie: | SCNN1B |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Insulin Receptor Signaling Pathway,Neuroscience. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using SCNN1B Rabbit pAb (A1765) at 1:3000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
