SCNN1B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A1765
Article Name: SCNN1B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A1765
Supplier Catalog Number: A1765
Alternative Catalog Number: ABB-A1765-100UL,ABB-A1765-20UL,ABB-A1765-1000UL,ABB-A1765-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: BESC1, ENaCb, SCNEB, LIDLS1, PHA1B2, ENaCbeta, beta-ENaC, beta-NaCH, SCNN1B
Nonvoltage-gated, amiloride-sensitive, sodium channels control fluid and electrolyte transport across epithelia in many organs. These channels are heteromeric complexes consisting of 3 subunits: alpha, beta, and gamma. This gene encodes the beta subunit, and mutations in this gene have been associated with pseudohypoaldosteronism type 1 (PHA1), and Liddle syndrome.
Clonality: Polyclonal
Molecular Weight: 73kDa
NCBI: 6338
UniProt: P51168
Purity: Affinity purification
Sequence: YPLPRGEKYCNNRDFPDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLSQERDQSTNITLSRKGIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWITIIKLVALAKSLRQRRAQASYAGPPPTVAELVEAHTNFGFQPDTAPRSPNTGPYPSEQALPIPGTPPPNYDSLRLQPLDVIESDSEGDAI
Target: SCNN1B
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Insulin Receptor Signaling Pathway,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using SCNN1B Rabbit pAb (A1765) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.