RTF1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17657
Artikelname: RTF1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17657
Hersteller Artikelnummer: A17657
Alternativnummer: ABB-A17657-20UL,ABB-A17657-100UL,ABB-A17657-1000UL,ABB-A17657-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: GTL7, KIAA0252, RTF1
This locus may represent a gene involved in regulation of transcription elongation and chromatin remodeling, based on studies of similar proteins in other organisms. The encoded protein may bind single-stranded DNA.
Klonalität: Polyclonal
Molekulargewicht: 80kDa
NCBI: 23168
UniProt: Q92541
Reinheit: Affinity purification
Sequenz: LAKKQPLKTSEVYSDDEEEEEDDKSSEKSDRSSRTSSSDEEEEKEEIPPKSQPVSLPEELNRVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNHNSKPVY
Target-Kategorie: RTF1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Stem Cells. Shipping: Ice Bag
Western blot analysis of various lysates using RTF1 Rabbit pAb (A17657) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.