RTF1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17657
Article Name: RTF1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17657
Supplier Catalog Number: A17657
Alternative Catalog Number: ABB-A17657-20UL,ABB-A17657-100UL,ABB-A17657-1000UL,ABB-A17657-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: GTL7, KIAA0252, RTF1
This locus may represent a gene involved in regulation of transcription elongation and chromatin remodeling, based on studies of similar proteins in other organisms. The encoded protein may bind single-stranded DNA.
Clonality: Polyclonal
Molecular Weight: 80kDa
NCBI: 23168
UniProt: Q92541
Purity: Affinity purification
Sequence: LAKKQPLKTSEVYSDDEEEEEDDKSSEKSDRSSRTSSSDEEEEKEEIPPKSQPVSLPEELNRVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNHNSKPVY
Target: RTF1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Stem Cells. Shipping: Ice Bag
Western blot analysis of various lysates using RTF1 Rabbit pAb (A17657) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.