ABHD12 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A17678
- Bilder (1)
| Artikelname: | ABHD12 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A17678 |
| Hersteller Artikelnummer: | A17678 |
| Alternativnummer: | ABB-A17678-100UL,ABB-A17678-20UL,ABB-A17678-500UL,ABB-A17678-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PHARC, ABHD12A, BEM46L2, hABHD12, C20orf22, dJ965G21.2, ABHD12 |
| This gene encodes an enzyme that catalyzes the hydrolysis of 2-arachidonoyl glycerol (2-AG), the main endocannabinoid lipid transmitter that acts on cannabinoid receptors, CB1 and CB2. The endocannabinoid system is involved in a wide range of physiological processes, including neurotransmission, mood, appetite, pain appreciation, addiction behavior, and inflammation. Mutations in this gene are associated with the neurodegenerative disease, PHARC (polyneuropathy, hearing loss, ataxia, retinitis pigmentosa, and cataract), resulting from an inborn error of endocannabinoid metabolism. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 45kDa |
| NCBI: | 26090 |
| UniProt: | Q8N2K0 |
| Reinheit: | Affinity purification |
| Sequenz: | YFIDLKKPQDQGLNHTCNYYLQPEEDVTIGVWHTVPAVWWKNAQGKDQMWYEDALASSHPIILYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGDSVGTPSERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTG |
| Target-Kategorie: | ABHD12 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Rat. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using ABHD12 Rabbit pAb (A17678) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Produktgarantie und fachkundiger Support
