ABHD12 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A17678
- Images (1)
| Article Name: | ABHD12 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A17678 |
| Supplier Catalog Number: | A17678 |
| Alternative Catalog Number: | ABB-A17678-100UL,ABB-A17678-20UL,ABB-A17678-500UL,ABB-A17678-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | PHARC, ABHD12A, BEM46L2, hABHD12, C20orf22, dJ965G21.2, ABHD12 |
| This gene encodes an enzyme that catalyzes the hydrolysis of 2-arachidonoyl glycerol (2-AG), the main endocannabinoid lipid transmitter that acts on cannabinoid receptors, CB1 and CB2. The endocannabinoid system is involved in a wide range of physiological processes, including neurotransmission, mood, appetite, pain appreciation, addiction behavior, and inflammation. Mutations in this gene are associated with the neurodegenerative disease, PHARC (polyneuropathy, hearing loss, ataxia, retinitis pigmentosa, and cataract), resulting from an inborn error of endocannabinoid metabolism. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. |
| Clonality: | Polyclonal |
| Molecular Weight: | 45kDa |
| NCBI: | 26090 |
| UniProt: | Q8N2K0 |
| Purity: | Affinity purification |
| Sequence: | YFIDLKKPQDQGLNHTCNYYLQPEEDVTIGVWHTVPAVWWKNAQGKDQMWYEDALASSHPIILYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGDSVGTPSERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTG |
| Target: | ABHD12 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Rat. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using ABHD12 Rabbit pAb (A17678) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Product Guarantee and Expert Support
