STEAP1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17684
Artikelname: STEAP1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17684
Hersteller Artikelnummer: A17684
Alternativnummer: ABB-A17684-100UL,ABB-A17684-20UL,ABB-A17684-1000UL,ABB-A17684-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: STEAP, PRSS24, STEAP1
This gene is predominantly expressed in prostate tissue, and is found to be upregulated in multiple cancer cell lines. The gene product is predicted to be a six-transmembrane protein, and was shown to be a cell surface antigen significantly expressed at cell-cell junctions.
Klonalität: Polyclonal
Molekulargewicht: 40kDa
NCBI: 26872
UniProt: Q9UHE8
Reinheit: Affinity purification
Sequenz: MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAI
Target-Kategorie: STEAP1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer. Shipping: Ice Bag
Western blot analysis of various lysates using STEAP1 Rabbit pAb (A17684) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.