STEAP1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17684
Article Name: STEAP1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17684
Supplier Catalog Number: A17684
Alternative Catalog Number: ABB-A17684-100UL,ABB-A17684-20UL,ABB-A17684-1000UL,ABB-A17684-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: STEAP, PRSS24, STEAP1
This gene is predominantly expressed in prostate tissue, and is found to be upregulated in multiple cancer cell lines. The gene product is predicted to be a six-transmembrane protein, and was shown to be a cell surface antigen significantly expressed at cell-cell junctions.
Clonality: Polyclonal
Molecular Weight: 40kDa
NCBI: 26872
UniProt: Q9UHE8
Purity: Affinity purification
Sequence: MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAI
Target: STEAP1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer. Shipping: Ice Bag
Western blot analysis of various lysates using STEAP1 Rabbit pAb (A17684) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.