RNF115 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A17687
Artikelname: RNF115 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A17687
Hersteller Artikelnummer: A17687
Alternativnummer: ABB-A17687-100UL,ABB-A17687-20UL,ABB-A17687-1000UL,ABB-A17687-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: BCA2, ZFP364, ZNF364, RABRING7, RNF115
Enables ubiquitin-protein transferase activity. Involved in negative regulation of epidermal growth factor receptor signaling pathway, protein autoubiquitination, and ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway. Predicted to be located in cytosol.
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 27246
UniProt: Q9Y4L5
Reinheit: Affinity purification
Sequenz: SPKLPEYICPRCESGFIEEVTDDSSFLGGGGSRIDNTTTTHFAELWGHLDHTMFFQDFRPFLSSSPLDQDNRANERGHQTHTDFWGARPPRLPLGRRYRSRGSSRPDRSPA
Target-Kategorie: RNF115
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Rat. Shipping: Ice Bag
Western blot analysis of lysates from Rat brain, using RNF115 Rabbit pAb (A17687) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.