RNF115 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17687
Article Name: RNF115 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17687
Supplier Catalog Number: A17687
Alternative Catalog Number: ABB-A17687-100UL,ABB-A17687-20UL,ABB-A17687-1000UL,ABB-A17687-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: BCA2, ZFP364, ZNF364, RABRING7, RNF115
Enables ubiquitin-protein transferase activity. Involved in negative regulation of epidermal growth factor receptor signaling pathway, protein autoubiquitination, and ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway. Predicted to be located in cytosol.
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 27246
UniProt: Q9Y4L5
Purity: Affinity purification
Sequence: SPKLPEYICPRCESGFIEEVTDDSSFLGGGGSRIDNTTTTHFAELWGHLDHTMFFQDFRPFLSSSPLDQDNRANERGHQTHTDFWGARPPRLPLGRRYRSRGSSRPDRSPA
Target: RNF115
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Rat. Shipping: Ice Bag
Western blot analysis of lysates from Rat brain, using RNF115 Rabbit pAb (A17687) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.